
Fundamentals of Homology Modeling in Bioinformatics
March 14, 2024Introduction to Homology Modeling
Homology modeling, also known as comparative modeling, is a computational method used to predict the three-dimensional structure of a protein based on its similarity to known protein structures. The principles of homology modeling are based on the assumption that proteins with similar sequences are likely to adopt similar structures and functions. Here are the key principles of homology modeling:
- Sequence Alignment: The first step in homology modeling is to align the target protein sequence with one or more template protein sequences whose structures have been experimentally determined.
- Homology Assessment: The degree of sequence similarity between the target protein and the template(s) is assessed using bioinformatics tools such as BLAST or PSI-BLAST. Higher sequence similarity indicates a closer evolutionary relationship and higher likelihood of structural similarity.
- Model Building: Once a suitable template is identified, the three-dimensional structure of the target protein is predicted by constructing a model that mimics the structure of the template. This is typically done using software that can generate coordinates for the atoms in the model.
- Model Refinement: The initial model is refined to improve its quality and accuracy. This may involve adjusting the backbone and side-chain conformations, optimizing hydrogen bonding, and minimizing steric clashes.
- Validation: The final model is validated using various techniques to ensure its reliability and accuracy. This may include assessing the stereochemical quality, checking for structural errors, and comparing the model to experimental data if available.
- Application: The homology model can be used for various purposes, such as understanding protein function, predicting the effects of mutations, and designing novel proteins with specific properties.
Homology modeling is a powerful tool in structural biology and drug discovery, as it allows researchers to study proteins that are difficult to crystallize or experimentally characterize. However, it is important to note that homology models are predictions and should be interpreted with caution, especially if the sequence similarity between the target and template is low.
Importance and applications in bioinformatics and structural biology
Homology modeling is of great importance in bioinformatics and structural biology due to its wide range of applications. Here are some key aspects:
- Structural Prediction: Homology modeling allows researchers to predict the three-dimensional structures of proteins based on their amino acid sequences. This is particularly useful for proteins whose structures have not been experimentally determined.
- Functional Annotation: By predicting the structure of a protein, homology modeling can provide insights into its function. This information is valuable for understanding biological processes and designing experiments to study protein function.
- Drug Discovery: Homology modeling is used in drug discovery to predict the structure of a protein target, such as a receptor or enzyme, that is involved in a disease. This information can be used to design small molecules that bind to the target and modulate its activity, leading to the development of new drugs.
- Protein Engineering: Homology modeling can be used to design novel proteins with specific functions or properties. By predicting the structure of a protein and making targeted modifications to its sequence, researchers can create proteins with improved stability, activity, or binding specificity.
- Evolutionary Studies: Comparing homology models of related proteins can provide insights into their evolutionary relationships and the structural basis of their differences in function. This information can help researchers understand how proteins evolve and adapt to different environments.
- Structure-Function Relationships: Homology modeling can be used to study the relationship between protein structure and function. By comparing the structures of proteins with different functions but similar structures, researchers can identify key structural features that are important for function.
Overall, homology modeling is a versatile tool that has a wide range of applications in bioinformatics and structural biology. It allows researchers to study proteins at the atomic level, providing insights into their structure, function, and evolution.
Overview of comparative protein structure modeling
Comparative protein structure modeling, also known as homology modeling, is a computational technique used to predict the three-dimensional structure of a protein based on its amino acid sequence and the known structure of a related protein(s) (template). Here is an overview of the process:
- Sequence Alignment: The first step is to align the target protein sequence with the sequences of one or more template proteins whose structures have been experimentally determined. This alignment is crucial for accurately predicting the structure of the target protein.
- Template Selection: The template protein(s) with the highest sequence similarity to the target protein are selected. The quality of the alignment between the target and template sequences is assessed to ensure that it is reliable.
- Model Building: Based on the alignment, a preliminary model of the target protein is built using the coordinates of the atoms in the template structure(s). The model is constructed by transferring the coordinates of equivalent residues from the template to the target sequence.
- Model Refinement: The initial model is refined to improve its quality and accuracy. This may involve adjusting the backbone and side-chain conformations, optimizing hydrogen bonding, and minimizing steric clashes.
- Validation: The final model is validated using various techniques to ensure its reliability and accuracy. This may include assessing the stereochemical quality, checking for structural errors, and comparing the model to experimental data if available.
- Application: The homology model can be used for various purposes, such as understanding protein function, predicting the effects of mutations, and designing novel proteins with specific properties.
It’s important to note that while homology modeling is a powerful tool, the accuracy of the predicted model depends on the quality of the sequence alignment and the similarity between the target and template proteins. Therefore, the model should be interpreted with caution, especially if the sequence similarity is low.
Understanding Protein Structure
Basics of protein structure
Homology Modeling Exercise
We will investigate the structure of the influenza virus neuraminidase protein and look at how its function may be blocked by using the neuraminidase inhibitor oseltamivir, the active ingredient in the drug Tamiflu.
- The substrate of influenza virus neuraminidase is sialic acid. The structures of sialic acid and the drugs oseltamivir (in Tamiflu) and zanamivir (in Relenza) are shown below (from P.J. Collins et al., Nature 453, 1258 (2008)).

Briefly describe the similarities and differences between enzyme substrate, sialic acid, and the enzyme inhibitors.
- The structure of an N2 neuraminidase with sialic acid bound in the active site can be found in the PDB entry 2BAT. A N1 neuraminidase with the active site blocked by oseltamivir can be found in 2HU4. Some naturally occurring mutated variants of viral neuraminidase have been found to give rise to Tamiflu-resistant strains of influenza. One such mutant is avian influenza N1 His274Tyr. According to P.J. Collins et al. (Nature 453, 1258 (2008)), this mutant binds oseltamivir with much lower affinity than the wild-type enzyme. Enzyme inhibition is reduced by a factor ~265. The structure of oseltamivir bound to His274Tyr N1 neuraminidase can be found in the PDB-structure 3CL0.
Download the “PyMOL scene” or “PyMOL session” from this website. Save the file on your Desktop and open it in PyMOL. This PyMOL session contains:
- 2HU4, chain A: A wild-type N1 neuraminidase bound to oseltamivir (green)
- 2BAT, chain A: A wild-type N2 neuraminidase bound to sialic acid (blue)
- 3CL0, chain A: A His274Tyr N1 mutant bound to oseltamivir (yellow)
- The proteins are shown in cartoon rendering and the ligands as sticks. You could easily have generated this “scene” yourself (and saved it as a PyMOL session), but we do not have time for that now! Actually, if you have used PyMOL a bit before and have the time, please download the PDB files and get the 3 structures into the same session. That is, do it “properly”.
It is much easier to see similarities and differences if we align the structures in 3D space. Type “align 2HU4, 2BAT” (watch the screen as you tap “enter”!) to make a superimposition of these two structures. This is PyMOL’s variant of intermolecular alignment. One of the structures is translated and rotated in order to get the lowest possible RMSD with respect to the other. Which of the two structures were moved?
- Align also 3CL0 with the two others. Does sialic acid and oseltamivir bind in the same pocket on the enzyme surface? Would you describe the structures as identical? Similar? Dissimilar?

- We will now look at 2HU4 only. Turn off the two other objects in the mini-menu on the right-hand side of the viewer window. You now see only wild-type N1 neuraminidase bound to oseltamivir in the active-site pocket.
- “oselt-WT” is a selection containing only the oseltamivir molecule. Click on the selection to get that confirmed. Make a new selection containing only residues within 8 Å of oseltamivir, i.e. the “active-site region”. To do this type “select ActSite, oselt-WT around 8”. Hide everything and then show both oseltamivir and ActSite as “sticks”. Color them “by element” but use different colors for the C-atoms making it easy to see both the oseltamivir and the protein residues. Hide everything else. You should now be able to see all the residues of the neuramidase packing around oseltamivir (as seen below).

- For the (ActSite) selection, do “L” → “residues” to get these residues labeled.
- You can let PyMOL make an attempt on localizing H-bonds between oseltamivir and the protein by doing for the (oselt-WT) selection: “Actions” → “find” → “polar contacts” → “to other atoms in object”. As you see, there are too many H-bonds, but at least you get some idea.
- List two acidic residues forming H-bonds to oseltamivir. Which basic residue is donating an H-bond to the amide group of oseltamivir? Two other basic residues contact the carboxyl group of oseltamivir. Which are they? One of them is even involved in strong, so-called “bidentate” H-bonding. Which one? List some other residues involved in van der Waals interactions packing with oseltamivir.
- Turn on all three objects again, 2HU4, 2BAT, and 3CL0. Find residue 274 in the three structures. Show them as sticks. What are they? What can you say about the properties of these residues?
- Color the three objects differently, but “by element”. Now you see the (aligned) active site residues of the three enzymes.
- Above you have identified several residues involved in forming H-bonds with oseltamivir: Glu119, Asp151, Arg152, Arg292 and Arg371. Are these residues conserved in all three neuraminidases? What can you say about the conformations/rotamers of the side chains for these residues? Why do you think these residues are conserved? What would happen if for example the mutation Glu119Trp was introduced? Would the enzyme be inhibited by oseltamivir? Would it have any activity on sialic acid? Can you find any active site residues that are not conserved between the three neuraminidases?
- Locate residues 274 and Glu276. Take a closer look at the conformation of Glu276 in the 3 structures. Are you able to explain why the His274Tyr mutant binds oseltamivir less efficiently than the wild-type enzyme? Can you explain why His274Tyr is “allowed”, i.e. the enzyme has wild-type activity on its substrate? Why is this mutation particularly good for the virus and bad for the doctor trying to treat a patient with Tamiflu?

Now let us try some modeling!
- You have a cousin working for Médecins Sans Frontières near Goroka in Papua New Guinea. You get this e-mail from her:
Dear cousin,
we have some serious problems here with an outbreak of an influenza-like disease. We have high mortality rates and it appears to be highly contagious. We have some indications that this might be an oseltamivir-resistant strain of influenza. I remember you told me about that bioinformatics course and perhaps you can help me with some quick modeling. It will be much faster than going to the lab and we are certainly in a hurry here 🙁
Through another contact we managed to get the neuraminidase gene from this virus sequenced:
>Possible neuraminidase [Putative influenza A virus (Goroka)]
MNPNQKILTIGSVSLSIATICFLMQIAILVSTVTLHFKQYECNSPPQNQVMLCDPTIIERNITEIVYLTNTT
IEREICPRLAEYKNWTRPQCDISGFAPYSKDNSIRLSAGGDIWVIREPYLSCDPDKCYQFILGQGSTLNNVH
SNDTVHDRTPYRTLMMNELGVPFHLGTKNVCIAWSTSSCHDGKAWLHVCVMGDDKNASATFIYNGRLVDSIV
SWSRKILRTQESECVCINGSCTVVMQDGSASGKADTKILFIEDGKILHTSTLSGSAQHVEECSCYPRYPGVK
CVCRDNWKGSNRPLVDINIDYSIVTSYVCSGLIGDTPRRNDSSSSSHCLDPQNEEGGHGVKGWAFDDGNDVW
MGRTISEKLRSGYESFKVIEGWSKPNSKLNIRQVIVERGNRSGYSGIFSVEGRSCINRCFYVELIRGRKDET
EVLWTSSSIVVFCGTSGTYGTGSWPDGADL
Can you have a look at this and give me feedback? Can structural bioinformatics tell us anything about this strain? Might it be resistant to Tamiflu?
Please help us,
Your cousin
What should you do? In this case, would you recommend trying to crystallize the protein and investigate the structure by X-ray crystallography? Why not?
You decide that you will try homology modeling for the Goroka neuraminidase. What are the 6 steps involved?
Go to the NCBI website (http://blast.ncbi.nlm.nih.gov/Blast.cgi) and do “protein blast”. Use the Goroka-sequence as a query sequence, use blastp and search the pdb-database for possible templates. Make sure you use the pdb-database, and nothing else! Do you find any templates that are suitable for homology modeling? Search for the string “2HTY” on the results page. Below the header at the sequence alignment for this hit click on “See 23 more title(s)” to find 2HU4. Is 2HU4, containing oseltamivir, a possible template? What is the sequence identity between the template 2HU4 and the target (Goroka sequence)? Does homology modeling appear to be a possibility? Will you be able to use 2HU4 for modeling the full-length protein?
- The sequence alignment you got from blastp is the following, in CLUSTAL format:
CLUSTAL
Target CDISGFAPYSKDNSIRLSAGGDIWVIREPYLSCDPDKCYQFILGQGSTLNNVHSNDTVHD
Templ CPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKD
Target RTPYRTLMMNELG-VPFHLGTKNVCIAWSTSSCHDGKAWLHVCVMGDDKNASATFIYNGR
Templ RSPHRTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGI
Target LVDSIVSWSRKILRTQESECVCINGSCTVVMQDGSASGKADTKILFIEDGKILHTSTLSG
Templ ITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFKMEKGKVVKSVELDA
Target SAQHVEECSCYPRYPGVKCVCRDNWKGSNRPLVDINIDYSIVTSYVCSGLIGDTPRRNDS
Templ PNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDG
Target SSSSHCLDPQNEEGGHGVKGWAFDDGNDVWMGRTISEKLRSGYESFKVIEGWSKPNSKLN
Templ TGS—CGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFS
Target IRQVIVERGNRSGYSGIF—-SVEGRSCINRCFYVELIRGRKDETEVLWTSSSIVVFCG
Templ VKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKES-TIWTSGSSISFCG
Target TSGTYGTGSWPDGADL
Templ VNSDTVGWSWPDGAEL
How many indels (insertions/deletions) are there? Is getting the correct sequence alignment important for homology modeling? How could you improve the alignment?
- In order to do homology modeling for the Goroka target sequence, go to the SWISS-MODEL website (http://swissmodel.expasy.org). Click on “Start Modelling”. You can create an account, but that is not necessary for this exercise. Instead of using the default mode under “Modelling” which is the simplest (but might give more errors) we will try “Alignment Mode“. We need a good alignment to start this job. However, due to lack of time, we will try to use the alignment we got from blastp above. Open the template structure in PyMOL (for example the file
http://folk.uio.no/jonkl/pubstuff/2hu4ChA.pdb). Show as “cartoon” or “ribbon”. Locate the positions of the indels in the alignment above. Are they in loops/coils, as they should preferably be, or in helices/sheets? One of the indels is at the end of a beta strand, and we will move it into the loop after this strand by changing
Target IRQVIVERGNRSGYSGIF—-SVEGRSCINRCFYVELIRGRKDETEVLWTSSSIVVFCG
Templ VKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKES-TIWTSGSSISFCG
to
Target IRQVIVERGNRSGYSGIFSVE—-GRSCINRCFYVELIRGRKDETEVLWTSSSIVVFCG
Templ VKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKES-TIWTSGSSISFCG
Actually, what we have done here is to remove a very short alpha helix. It is only four residues and not much of an alpha helix anyway. We did this to move the indels out of the core of the protein and the main secondary structure elements. This gives us the following alignment of target and template, in CLUSTAL and FASTA format, respectively:
CLUSTAL
Target CDISGFAPYSKDNSIRLSAGGDIWVIREPYLSCDPDKCYQFILGQGSTLNNVHSNDTVHD
Templ CPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKD
Target RTPYRTLMMNELG-VPFHLGTKNVCIAWSTSSCHDGKAWLHVCVMGDDKNASATFIYNGR
Templ RSPHRTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGI
Target LVDSIVSWSRKILRTQESECVCINGSCTVVMQDGSASGKADTKILFIEDGKILHTSTLSG
Templ ITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFKMEKGKVVKSVELDA
Target SAQHVEECSCYPRYPGVKCVCRDNWKGSNRPLVDINIDYSIVTSYVCSGLIGDTPRRNDS
Templ PNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDG
Target SSSSHCLDPQNEEGGHGVKGWAFDDGNDVWMGRTISEKLRSGYESFKVIEGWSKPNSKLN
Templ TGS—CGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFS
Target IRQVIVERGNRSGYSGIFSVE—-GRSCINRCFYVELIRGRKDETEVLWTSSSIVVFCG
Templ VKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKES-TIWTSGSSISFCG
Target TSGTYGTGSWPDGADL
Templ VNSDTVGWSWPDGAEL
>Target
CDISGFAPYSKDNSIRLSAGGDIWVIREPYLSCDPDKCYQFILGQGSTLNNVHSNDTVHDRTPYRTLMMNEL
G-VPFHLGTKNVCIAWSTSSCHDGKAWLHVCVMGDDKNASATFIYNGRLVDSIVSWSRKILRTQESECVCIN
GSCTVVMQDGSASGKADTKILFIEDGKILHTSTLSGSAQHVEECSCYPRYPGVKCVCRDNWKGSNRPLVDIN
IDYSIVTSYVCSGLIGDTPRRNDSSSSSHCLDPQNEEGGHGVKGWAFDDGNDVWMGRTISEKLRSGYESFKV
IEGWSKPNSKLNIRQVIVERGNRSGYSGIFSVE—-GRSCINRCFYVELIRGRKDETEVLWTSSSIVVFCG
TSGTYGTGSWPDGADL
>Templ
CPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPV
GEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVN
GSCFTVMTDGPSNGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFN
QNLEYQIGYICSGVFGDNPRPNDGTGS—CGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWD
PNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKES-TIWTSGSSISFCG
VNSDTVGWSWPDGAEL
- Back at the SWISS-MODEL workspace now paste in the alignment of target and template in FASTA format that you find above. Wait for the possible templates to be loaded. Choose structure 2HU4, biological assembly 1, chain A, which is the structure you have looked at earlier, and click “Build Model”. Wait for the job to finish… Or actually continue further down!
- Did the “Alignment Mode” job finish? If you do not have time to wait, log into Jon’s account to get access to the results (Ask for the account name and password). Look at the “Modelling Logs” in the pull-down menu next to the picture of the model at the left. How many loops were modeled? Do they appear to be ok? Take a look at the “Quality estimates”. Which parts of the model does not seem to be of the best quality? Look at the red/blue coloring to get an idea. Is any of the problematic areas close to the active site?

- You could have downloaded the model PDB-file to your computer, but for now, instead use a model that has been made earlier. It is the same model that you have generated with SWISS-MODEL, but in addition the modelers have used a molecular mechanics/force field program to “relax” the structure (they ran a few iterations of geometry optimization) in order to get rid of collisions between tight-packing residues. The final, “relaxed” model, aligned with the template 2HU4, chain A, is found here: http://folk.uio.no/jonkl/pubstuff/2HU4chA_GorokaTemplN1.pse. Can you locate the loops that have been modeled at the indels?
You could have checked the quality of the model at the SWISS-MODEL workspace, but we will just trust the model for now. Anyway, this model is not very good since we have used a quick and dirty alignment. But it is good enough for our task: find out if it is likely that the new virus strain can be treated with Tamiflu.
- The selection “oselt” contains the atoms of the oseltamivir inhibitor in 2HU4 chain A. Make a selection containing only residue 274 of the same chain. Rename it “274”. Color 2HU4 blue and the model yellow. Hide everything. Now type “select Actsite, oselt around 8” and “select Exten, 274 around 8”. Show both these selections as sticks and color “by element”, the first choice on the list. Do the same with “274”. Show also G39 as sticks and in a third type of “by element” coloring.

- Take a close look at the residues interacting with oseltamivir in the pocket of 2HU4 and in the model of the Goroka neuraminidase. Can you see any differences between the two structures that might explain the putative oseltamivir resistance? What do you suggest to tell your cousin?
- Find 2HU4, 2BAT, and 3CL0 in the PDB and have a look at the corresponding pdb-files in PyMOL. There are several chains in all these PDB entries. Can you say anything about the quaternary structure of neuraminidase from these structures? Do the pdb-files contain the structures of full-length proteins? Use chain A from the three pdb-files and make a session such as the one you started with in this exercise.
- Take a look at the various model quality estimation tools at the SWISS-MODEL Workspace. Is the model ok, or not. What seems to be the problem? Upload the 2HU4 chain A PDB file and run it through the same tools. Are the results any better?
- Try to improve the alignment of target and template by using the information from homologous proteins. Use the improved alignment to generate a new model for the Goroka neuraminidase. Do you get a better model?
- Do a blastp search with your favorite protein as query in the PDB sequence database. Do you find any templates that can be used for homology modeling? You might also try fold recognition, for example GenTHREADER (http://bioinf.cs.ucl.ac.uk/psipred) or Phyre2 (http://www.sbg.bio.ic.ac.uk/~phyre2).
Future Directions and Trends
Future directions and trends in homology modeling are influenced by emerging technologies, advancements in machine learning and AI, and evolving career opportunities in structural bioinformatics. Here’s an overview:
- Emerging Technologies in Homology Modeling:
- Cryo-electron microscopy (cryo-EM) is revolutionizing structural biology by enabling the determination of high-resolution structures of macromolecular complexes.
- Integrative modeling approaches that combine data from multiple sources, such as cryo-EM, X-ray crystallography, and NMR spectroscopy, are becoming increasingly important for modeling complex biological systems.
- Integration of Machine Learning and AI:
- Machine learning and AI techniques are being integrated into homology modeling to improve modeling accuracy and efficiency.
- Deep learning methods, such as convolutional neural networks (CNNs) and recurrent neural networks (RNNs), are being used to predict protein structures and refine models based on large datasets.
- Career Opportunities and Advancements in Structural Bioinformatics:
- Structural bioinformatics offers a wide range of career opportunities in academia, industry, and government agencies.
- Advancements in structural bioinformatics are driving innovations in drug discovery, protein engineering, and personalized medicine, creating new opportunities for researchers and practitioners in the field.
- Hybrid Approaches and Integrative Modeling:
- Hybrid modeling approaches that combine homology modeling with experimental data and computational methods are becoming increasingly important for modeling complex biological systems.
- Integrative modeling approaches that combine data from multiple sources, such as cryo-EM, X-ray crystallography, and NMR spectroscopy, are becoming standard practice for modeling large macromolecular complexes.
- Structural Bioinformatics in Drug Discovery and Precision Medicine:
- Structural bioinformatics plays a key role in drug discovery by enabling the design of novel therapeutics and the prediction of drug-target interactions.
- In precision medicine, structural bioinformatics is used to analyze genetic variation and predict the effects of mutations on protein structure and function, leading to personalized treatment strategies.
Overall, the future of homology modeling and structural bioinformatics is promising, with advancements in technology and computational methods driving new opportunities for research and innovation in the field.
Conclusion and Recap
In conclusion, we have covered several key concepts and techniques in homology modeling, a fundamental method in structural bioinformatics. Here is a summary:
- Homology Modeling: Homology modeling is a computational technique used to predict the three-dimensional structure of a protein based on its similarity to a known protein structure (template).
- Steps in Homology Modeling: The key steps in homology modeling include template selection, sequence alignment, model building, and model refinement.
- Tools and Software: Popular homology modeling software includes MODELLER, SWISS-MODEL, and Phyre2, among others. These tools enable researchers to predict protein structures and study their functions.
- Model Evaluation and Validation: Techniques such as Ramachandran plot analysis, MolProbity, VERIFY3D, and ProSA-web are used to assess the quality of homology models and validate their accuracy.
- Advanced Topics: Advanced topics in homology modeling include incorporating structural information from templates, dealing with gaps and insertions in the alignment, and handling template modeling errors.
- Future Directions and Trends: Future directions in homology modeling include the integration of emerging technologies, such as machine learning and AI, to improve modeling accuracy. There are also promising career opportunities and advancements in structural bioinformatics for those interested in pursuing this field.
For further learning in homology modeling, you can explore resources such as:
- Online courses and tutorials on homology modeling offered by universities and online learning platforms.
- Research articles and journals in the field of structural bioinformatics.
- Books on protein structure and modeling, such as “Introduction to Protein Structure” by Branden and Tooze, and “Principles of Protein Structure” by Schulz and Schirmer.
- Workshops and conferences on structural bioinformatics and protein modeling.
Continuing to explore these resources will deepen your understanding of homology modeling and its applications in structural biology and bioinformatics.
















