Word image 4558

Understanding PSI-BLAST: A Comprehensive Guide

March 22, 2024 Off By admin
Shares

Introduction to Protein Sequence Alignment

Sequence alignment is a fundamental task in bioinformatics, essential for comparing and understanding biological sequences such as DNA, RNA, and proteins. It involves arranging these sequences to identify regions of similarity that may suggest functional, structural, or evolutionary relationships. Here’s a brief overview of common sequence alignment methods:

  1. Pairwise Sequence Alignment:
  2. Multiple Sequence Alignment (MSA):
  3. Database Search Tools:
    • BLAST (Basic Local Alignment Search Tool): Quickly finds regions of similarity between a query sequence and sequences in a database, useful for identifying homologous sequences.
  4. Structural Alignment:
    • DALI, CE, TM-align: Aligns sequences based on their three-dimensional structures, often used for protein structure comparison.
  5. Profile-based Methods:

Each method has its strengths and weaknesses, and the choice of method depends on the specific goals of the analysis, such as identifying conserved regions, structural similarities, or evolutionary relationships.

Importance of sequence alignment in bioinformatics

Sequence alignment is crucial in bioinformatics for several reasons:

  1. Homology Inference: It helps determine whether two sequences are evolutionarily related, indicating a common ancestor. This is vital for understanding evolutionary relationships, protein function, and structure.
  2. Functional Annotation: By aligning a newly sequenced protein with known proteins, researchers can infer its function based on conserved regions.
  3. Phylogenetic Analysis: Aligning sequences from different species helps reconstruct evolutionary trees, revealing the evolutionary history and relatedness of organisms.
  4. Mutation Analysis: It identifies mutations, insertions, deletions, and rearrangements in sequences, providing insights into genetic variations and their implications.
  5. Drug Discovery: Sequence alignment aids in identifying potential drug targets by comparing protein sequences of pathogens with host organisms.
  6. Genome Annotation: It helps annotate genomes by aligning DNA or RNA sequences with known functional elements, such as genes and regulatory regions.
  7. Structural Biology: Aligning protein sequences can guide the prediction of protein structures and the identification of conserved structural motifs.
  8. Metagenomics: Aligning sequences from environmental samples helps identify microbial species and understand microbial community structures.

Overall, sequence alignment is foundational in bioinformatics, enabling researchers to extract meaningful information from biological sequences and advancing our understanding of genetics, evolution, and disease

Basics of BLAST (Basic Local Alignment Search Tool)

The BLAST (Basic Local Alignment Search Tool) algorithm is a widely used tool in bioinformatics for comparing biological sequences. It is designed to quickly identify regions of similarity between a query sequence and sequences in a database. Here’s an overview of how the BLAST algorithm works:

  1. Word Search: BLAST breaks the query sequence into smaller overlapping words (typically 3-11 nucleotides for DNA or 2-3 amino acids for proteins) called “words” or “seeds.”
  2. Initial Matches: It searches the database for exact matches to these words, creating a list of potential regions of similarity.
  3. Scoring: BLAST assigns scores to these initial matches based on a scoring matrix (e.g., BLOSUM for proteins, PAM for DNA) that considers the biological relevance of substitutions, insertions, and deletions.
  4. Alignment Extension: It extends these initial matches to nearby regions, aligning the query sequence with the database sequence while considering gaps and mismatches.
  5. Scoring Alignment: BLAST calculates a final alignment score based on the sum of the scores for each match, mismatch, and gap.
  6. Statistical Significance: BLAST provides statistical measures (e.g., E-value, bit score) to assess the significance of the alignment, indicating the likelihood of the match occurring by chance.

BLAST is highly versatile and has several use cases and applications in bioinformatics:

  1. Sequence Similarity Search: BLAST is primarily used to search for similar sequences in large databases, allowing researchers to identify homologous sequences and infer functional and evolutionary relationships.
  2. Functional Annotation: It helps annotate newly sequenced genes or proteins by comparing them with sequences of known function.
  3. Identification of Conserved Domains: BLAST can identify conserved protein domains or motifs shared among different proteins, aiding in functional and structural predictions.
  4. Genomic and Metagenomic Analysis: BLAST is used to analyze whole genomes or metagenomic datasets to study genetic variations, gene function, and microbial diversity.
  5. Drug Discovery: BLAST can identify potential drug targets by comparing pathogen sequences with host sequences to find differences that could be exploited for drug development.
  6. Evolutionary Studies: BLAST is used in phylogenetic analysis to study evolutionary relationships by comparing sequences across different species.

Overall, BLAST is a versatile and powerful tool in bioinformatics, widely used for sequence analysis, functional annotation, and evolutionary studies.

Introduction to PSI-BLAST (Position-Specific Iterative BLAST)

PSI-BLAST (Position-Specific Iterated BLAST) is an extension of the basic BLAST algorithm that addresses some limitations of regular BLAST, making it particularly useful in certain scenarios. Here’s why PSI-BLAST is needed and its advantages over regular BLAST:

  1. Detecting Remote Homologs: Regular BLAST may miss detecting remote homologs (sequences that share a common ancestor but have diverged significantly). PSI-BLAST iteratively builds a position-specific scoring matrix (PSSM) based on the alignments found in the previous iterations, which can help detect more distant homologs.
  2. Enhanced Sensitivity: PSI-BLAST can often find more significant matches than regular BLAST, especially for sequences with low similarity, by using the PSSM to refine the search for similar sequences in subsequent iterations.
  3. Identification of Weakly Conserved Domains: PSI-BLAST is better at identifying weakly conserved domains or motifs in proteins, which may be important for protein function but are not easily detected by regular BLAST.
  4. Reducing False Positives: The iterative nature of PSI-BLAST helps reduce the number of false positive matches by iteratively refining the alignment based on the PSSM, leading to more reliable results.
  5. Profile-Based Search: PSI-BLAST effectively performs a profile-based search, where the query sequence is aligned against a profile of the database sequences, allowing for more sensitive and specific sequence similarity searches.
  6. Database Expansion: PSI-BLAST can be used to expand a search database by including sequences similar to the query sequence, which can be useful for studying protein families or evolutionary relationships.

In summary, PSI-BLAST is needed when regular BLAST fails to detect remote homologs or when higher sensitivity and specificity are required in sequence similarity searches. Its iterative approach and use of PSSMs make it a powerful tool for protein sequence analysis in bioinformatics

How PSI-BLAST Works

PSI-BLAST (Position-Specific Iterated BLAST) is an iterative search algorithm used to find distant homologs of a protein sequence. It works by iteratively building a position-specific scoring matrix (PSSM) based on the alignments found in previous iterations. Here’s how PSI-BLAST works:

  1. Initialization:
    • PSI-BLAST starts with a regular BLAST search using the query sequence against a protein sequence database (e.g., NCBI’s non-redundant protein database).
    • It generates an initial list of similar sequences (hits) along with their alignment scores.
  2. Building the PSSM:
    • The initial hits are used to build a PSSM, which is a matrix where each column represents a position in the aligned sequences, and each row represents an amino acid residue.
    • The PSSM contains information about the conservation of amino acids at each position based on the alignments found in the initial search.
  3. Iterative Searching:
    • The PSSM is used to perform another round of database searching. This time, the search is more sensitive because the PSSM considers the conservation of amino acids at each position.
    • New hits are identified based on the PSSM, and their alignments are used to update the PSSM.
  4. Convergence:
    • The iterative process continues for a predefined number of iterations or until convergence criteria are met (e.g., no new hits found).
    • The final PSSM represents a refined model of the query sequence, incorporating information from multiple iterations of database searching.
  5. Scoring and Reporting:
    • The final hits are scored based on the alignment with the PSSM, and statistical measures (e.g., E-value, bit score) are calculated to assess the significance of the matches.
    • PSI-BLAST reports the hits that pass a predefined significance threshold, along with their alignments and scores.

By iteratively refining the search model based on the alignments found in previous iterations, PSI-BLAST can detect remote homologs that may be missed by a single BLAST search. It is a powerful tool for protein sequence analysis, particularly in identifying evolutionarily related proteins with low sequence similarity.

Practical Guide to Using PSI-BLAST

Introduction

Earlier in the course you have used the BLAST program to perform fast alignments of DNA and protein sequences. As shown in today’s lecture, BLAST will often fail to recognize relationships between proteins with low sequence similarity. In today’s exercise, you will use the iterative BLAST program (PSI-BLAST) to calculate sequence profiles and see how such profiles can be used to:

Identify relationships between proteins with low sequence similarity

Identify conserved residues in protein sequences (residues important for the structural stability or function of the protein)

Links

NCBI BLAST: http://www.ncbi.nlm.nih.gov/BLAST/

When BLAST fails

Partial screenshot of the Blast interface. The red arrow shows the settings change to the database to pdb

Say you have a sequence (pasted below) and you want to make predictions about its function and structure. As seen earlier in the course, you will most often use BLAST to do this. However what happens when BLAST fails?

>QUERY1 MKDTDLSTLLSIIRLTELKESKRNALLSLIFQLSVAYFIALVIVSRFVRYVNYITYNNLV EFIIVLSLIMLIIVTDIFIKKYISKFSNILLETLNLKINSDNNFRREIINASKNHNDKNK LYDLINKTFEKDNIEIKQLGLFIISSVINNFAYIILLSIGFILLNEVYSNLFSSRYTTIS IFTLIVSYMLFIRNKIISSEEEEQIEYEKVATSYISSLINRILNTKFTENTTTIGQDKQL YDSFKTPKIQYGAKVPVKLEEIKEVAKNIEHIPSKAYFVLLAESGLRPGELLNVSIENID LKARIIWINKETQTKRAYFSFFSRKTAEFLEKVYLPAREEFIRANEKNIAKLAAANENQE IDLEKWKAKLFPYKDDVLRRKIYEAMDRALGKRFELYALRRHFATYMQLKKVPPLAINIL QGRVGPNEFRILKENYTVFTIEDLRKLYDEAGLVVLE

Go to the BLAST (http://www.ncbi.nlm.nih.gov/BLAST) web-site at NCBI. Select blastp as the algorithm. Paste in the query sequence. Change the database from nr to pdb, and press BLAST.

QUESTION 1: How many significant hits does BLAST find (E-value < 0.005)?

Trying another approach

Partial screenshot of the Psi-Blast interface. The red arrow shows the settings change to Psi-Blast.

Now go back to the BLAST (http://www.ncbi.nlm.nih.gov/BLAST) web-site. Paste in the query sequence  This time, set the database to nr and select PSI-BLAST (Position-Specific Iterated BLAST) as the algorithm. IMPORTANT: To ease the load on the NCBI server, limit the search to Archaea (TaxID 2157) when searching Query1 in nr.

QUESTION 2: How many significant hits does BLAST find (E-value < 0.005)? (Tip: you can see the number by selecting all significant hits (clicking All under Sequences producing significant alignments with E-value BETTER than threshold) and then looking at the number of selected hits)

QUESTION 3: How large a fraction (Query coverage) of the query sequence do the significant hits match (excluding the identical match)?

QUESTION 4: Do you find any PDB hits among the significant hits? (Tip: look for a PDB identifier in the Accession column — a PDB identifier is a 4 character code, where the first character is a number, followed by a single letter chain name, such as “1XYZ_A”)

Constructing the PSSM

Note: If you see the error message “Entrez Query: txid2157 [ORGN] is not supported”, then click Recent Results in the upper right part of the BLAST window, select your most recent search, and try again.

Now run a second BLAST iteration in order to construct a PSSM (Position-Specific Scoring Matrix). Press the Run button at Run PSI-Blast iteration 2 (you can find it at both the bottom and top of the results table).

QUESTION 5: How many significant hits does BLAST find (E-value < 0.005)?

QUESTION 6: How large a fraction of the query sequence do the 20 most significant hits match (do not include the first hit since this is identical to the query)?

QUESTION 7: Why does BLAST come up with more significant hits in the second iteration? Make sure you answer this question and understand what is going on!

Saving and reusing the PSSM

This time, we will not ask you to look for PDB identifiers manually among the significant hits. Instead, you should save the PSSM that PSI-BLAST has created and use it for searching PDB directly.

Go to the top of the PSI-BLAST output page and click Download All, then click PSSM. Save the file to a place on your computer where you can find it again! You can take a look at this file using Geany, but it is really not meant to be human-readable.

Then, open a new BLAST window (this is important—you need your first BLAST window again later) where you again select PSI-BLAST as the algorithm. Select pdb as the database. Do not limit your search to Archaea this time. Click on Algorithm parameters to show the extended settings. Click the button next to Upload PSSM and select the file you just saved. Note: You don’t have to paste the query sequence again, it is stored in the PSSM!

QUESTION 8: Do you find any significant PDB hits now? If yes, how many?

QUESTION 9: What are the PDB identifiers and the E-values for the two best PDB hits?

QUESTION 10: What are the values for Query coverage, sequence identity, and sequence similarity (Positives) for the two best PDB hits? (Tip: click on the description to get to the actual alignment between the query sequence and the PDB hit)?

QUESTION 11: What is the function of these proteins?

One more round

Let’s try one more iteration of PSI-BLAST:

Go back to your first BLAST window (the one with the results from the nr database limited to Archaea) and press the Run button at Run PSI-Blast iteration 3.

Save the resulting PSSM file (make sure you give it a different name!).

Launch a new PSI-BLAST search against pdb in all organisms using this PSSM (you may have to click on Clear to erase your first PSSM file from the server).

QUESTION 12: Answer questions 8-10 again for the new search.

Finding a remote homolog (on your own)

PSI-Blast is not only useful for finding a remote homolog in a specific database such as PDB — now it is time to search the broader database “Reference proteins” (refseq_protein). (Note: we would have liked to do this exercise in the broadest database nr, but that search runs into technical problems). PSI-BLAST can be used in the same way for finding a remote homolog in a specific organism or taxonomic group. Your task in this round is to find out whether the protein with the UniProt ID GPAA1_HUMAN has a homolog in the genus Trypanosoma (unicellular parasites which cause diseases like sleeping sickness or Chaga’s disease).

First, try a standard BlastP (where you set Organism to Trypanosoma, Database to refseq_protein (not refseq_select), switch the Low complexity regions filter off, and set the E-value threshold to 10).

QUESTION 13: Do you find any significant (E<0.005) hits? What is the E-value of the best hit?

Then, try PSI-BLAST. Hint: You need to search in all organisms (still using refseq_protein) to build a PSSM, then save your PSSM and use that to search in Trypanosoma.

QUESTION 14: How many significant (E<0.005) hits do you find now? What is the E-value of the best hit?

Concluding remarks

Now you have seen the power of sequence profiles in general and the PSI-BLAST program in particular. Using sequence profiles you have been able to identify a relationship between protein sequences far below 30% sequence similarity. Further, you have made qualified predictions on the protein function and selected a set of essential amino acids suitable for experimental validation of the structural and functional predictions.

Answers

When BLAST fails

QUESTION 1: How many significant hits does BLAST find (E-value < 0.005)?

Answer: No sequences with E-value below 0.005.

Trying another approach

QUESTION 2: How many significant hits does BLAST find (E-value < 0.005)?

Answer: After the first iteration, 363 hits are found.

QUESTION 3: How large a fraction of the query sequence do the significant hits match (excluding the identical match)?

Answer: For most hits between 45 and 55%. One hit (#2) is 84%. A few hits are lower, down to 11%.

QUESTION 4: Do you find any PDB hits among the significant hits?

Answer: No, of course not. If there were any significant PDB hits, we would have found them under QUESTION 1.

Constructing the PSSM

QUESTION 5: How many significant hits does BLAST find (E-value < 0.005)?

Answer: 500 (actually, much more than 500 hits, but BLAST by default only shows 500 — note that the last hit has an E-value much much smaller than 0.005)

QUESTION 6: How large a fraction of the query sequence do the 20 most significant hits match (do not include the first hit since this is identical to the query)?

Answer: approx. 50-60% sequence coverage, except one (#2) that is 84%.

QUESTION 7: Why does BLAST come up with more significant hits in the second iteration? Make sure you answer this question and understand what is going on!

Answer: During the first iteration a generic Blosum62 substitution matrix was used, and hits found there were made into a multiple alignment and next a more sensitive position-specific-substitution-matrix (PSSM). This is why more sequences are found in the second iteration. A PSSM can capture evolutionary sequence information

>5HXY_A Chain A, Crystal Structure Of Xera Recombinase

Length=317

Query 174 SRYTTISIFTLIVSYMLFIRNKIISSEEEEQIEYEKVATSYISSLINRILNTKFTENTTT 233 SRYT L+ ++ F K + Y+

D ++ + PK

V + +E K + +

A +LA +G+R GEL

+ + + D

+ + + R I + +A K+ + LR FAT +

i.e. conserved regions, active sites and regions with less evolutionary pressure (many different amino acids at a certain position).

Saving and reusing the PSSM

QUESTION 8: Do you find any significant PDB hits now? If yes, how many?

Answer: Yes, 13

QUESTION 9: What are the PDB identifiers and the E-values for the two best PDB hits?

Answer: 4A8E_A with an E-value of 2×10-20, 5HXY_A with an E-value of 3×10-20,

QUESTION 10: What are the values for Query coverage, sequence identity, and sequence similarity (Positives) for the two best PDB hits?

Answer:

IDcovidentsim/pos
4A8E_A46%21%40%
5HXY_A61%18%32%

Alignments:

K K KL P

L +K

R G

+ LR FAT+M + + I L

>4A8E_A Chain A, The Structure Of A Dimeric Xer Recombinase From Archaea
Query242DSFKTPKIQYGAKVPVKLEEIKEVAKNIEHIPSKAYFVLLAESGLRPGELLNVSIENIDL301
Sbjct90+ KTPK+ + EE++ + E + + +LL +GLR EL N+ +E+++EKLKTPKMPKTLPKSLTEEEVRRIINAAETLRDRLILLLLYGAGLRVSELCNLRVEDVNF149
Query302KARIIWINKETQTKRAYFSFFSRKTAEFLEKVYLPAREEFIRANEKNIAKLAAANENQEI361
Sbjct150+ +I + + + + S +++ YL +R + + +EYGVIVV-RGGKGGKDRVVPISESLLSEIKR-YLESRNDDSPYLFVEMKR———-197
Query362DLEKWKAKLFPYKDDVLRRKIYEAMDRALGKRFELYALRRHFATYMQLKKVPPLAINILQ421
Sbjct198—KRKDKLSPKTVWRLVKK YGRKAGVELTPHQLRHSFATHMLERGIDIRIIQELL250
Query Sbjct422251GRVGPNEFRILKENYTVFTIEDLRKLYDEAGL 453 G + +I YT + + L++ +A L GHSNLSTTQI—-YTKVSTKHLKEAVKKAKL 278
Sbjct56SRYTIKEYRFLVDQFLSFXNKKPDEITPXDIERYKNFLAVKKRYSKTSQYLAIKAVKLFY115
Query234IGQDKQLYDSFKTPKIQYGAKVPVKLEEIKEVAKNIE-HIPSKAYFVLLAESGLRPGELL292
Sbjct116KALDLRVPINLTPPKRPSHXPVYLSEDEAKRLIEAASSDTRXYAIVSVLAYTGVRVGELC175
Query293NVSIENIDLKARIIWINKETQTKRAYFSFFSRKTAEFLEKVYLPAREEFIRANEKNIAKL352
Sbjct176N+ I ++DL+ II + + + + + + + L YL RNLKISDVDLQESIINV-RSGKGDKDRIVIXAEECVKAL-GSYLDLR————–219
Query353AAANENQEIDLEKWKAKLFPYKDDVLRRKIYEAMDRALG-KRFELYALRRHFATYMQLKK411
Sbjct220–LSXDTDNDYLFVSNRRVRFDTSTIERXIRDLGKKAGIQKKVTPHVLRHTFATSVLRNG277
Query412VPPLAINILQGRVGPNEFRILKENYTVFTIEDLRKLYDEAGLV 454

I + G

+I YT

LR+ Y +

Sbjct 278 GDIRFIQQILGHASVATTQI—-YTHLNDSALREXYTQHRPR 316

QUESTION 11: What is the function of these proteins?

Answer: They are recombinases.

There are two families of site-specific recombinases; the resolvase/invertase family use a serine nucleophile to mediate a concerted double strand cleavage and rejoining reaction at nucleotide phosphates separated by 2 bp, while the lambda integrase family enzymes use a tyrosine nucleophile to mediate sequential pairs of strand exchanges that are positioned 6–8 bp apart. In site-specific recombination reactions mediated by both families, four recombinase molecules bound to two approx30 bp recombination core sites catalyse the breaking and rejoining of four DNA phosphodiester bonds.

One more round

QUESTION 12: Answer questions 8-10 again for the new search.

Answer: There are now 17 significant hits. The two best are still 4A8E_A and 5HXY_A.

ID 4A8E_AE5e-43cov 65%ident 18%sim/pos 34%
5HXY_A1e-4263%17%31%
Alignments:
>4A8E_A Chain A, The Structure Of A Dimeric Xer Recombinase From Archaea
Query154IILLSIGFILLNEVYSNLFS-SRYTTISIFTLIVSYMLFIRNKIISSEEEEQIEYEKVAT212
+IY LSR TI ++ S+ + +
Sbjct5EERVRDDTIEEFATYLELEGKSRNTVRMYTYYISKFFE EGHSPTARDALRFLAKLK60
QuerySbjct21361SYISSLINRILNTKFTENTTTIGQDKQLYDSFKTPKIQYGAKVPVKLEEIKEVAKNIEHI S + L + + + KTPK+ + EE++ + E + RKGYSTRSLNLVIQALKAYFKFEGLDSEAEKLKTPKMPKTLPKSLTEEEVRRIINAAETL272120
QuerySbjct273121PSKAYFVLLAESGLRPGELLNVSIENIDLKARIIWINKETQTKRAYFSFFSRKTAEFLEK+ +LL +GLR EL N+ +E+++ + +I + + + + S +++ RDRLILLLLYGAGLRVSELCNLRVEDVNFEYGVIVV-RGGKGGKDRVVPISESLLSEIKR332179
Query333VYLPAREEFIRANEKNIAKLAAANENQEIDLEKWKAKLFPYKDDVLRRKIYEAMDRALGK392
YL +R ++ +K K KL PL +KR G
Sbjct180-YLESRNDDSPYLFVEMKR————-KRKDKLSPKTVWRLVKK YGRKAGV221
Query393RFELYALRRHFATYMQLKKVPPLAINILQGRVGPNEFRILKENYTVFTIEDLRKLYDEAG452
+ LR FAT+M + +I L G+ +IYT + + L+++A
Sbjct222ELTPHQLRHSFATHMLERGIDIRIIQELLGHSNLSTTQI YTKVSTKHLKEAVKKAK277
Query Sbjct453278L 453 LL 278
>5HXY_A Chain A, Crystal Structure Of Xera Recombinase
Query163LLNEVYSNLFSSRYTTISIFTLIVSYMLFIRNKIISSEEEEQIEYEKVATSYISSLINRI222
E +SRYTL+ ++ FK+Y+
Sbjct45RFVEYXTGERKSRYTIKEYRFLVDQFLSFXNKKPDEITPXDIERYKNFLAVKKRYSKTSQ104
Query223LNTKFTENTTTIGQDKQLYDSFKTPKIQYGAKVPVKLEEIKEVAKNIE-HIPSKAYFVLL281
D ++ +PKV + +E K + +A+L
Sbjct105YLAIKAVKLFYKALDLRVPINLTPPKRPSHXPVYLSEDEAKRLIEAASSDTRXYAIVSVL164
Query282AESGLRPGELLNVSIENIDLKARIIWINKETQTKRAYFSFFSRKTAEFLEKVYLPAREEF341
Sbjct165AYTGVRVGELCNLKISDVDLQESIINV-RSGKGDKDRIVIXAEECVKAL-GSYLDLR—219
Query342IRANEKNIAKLAAANENQEIDLEKWKAKLFPYKDDVLRRKIYEAMDRALG-KRFELYALR400
Sbjct220————-LSXDTDNDYLFVSNRRVRFDTSTIERXIRDLGKKAGIQKKVTPHVLR266
Query401RHFATYMQLKKVPPLAINILQGRVGPNEFRILKENYTVFTIEDLRKLYDEAGLV 454

Finding a remote homolog (on your own)

A +G+R GEL N+ I ++DL+ II + + + +

+ + + L YL R

+ + + D

+ + + R I + +A K+ + LR

FAT +

I + G

+I YT

LR+ Y +

Sbjct 267 HTFATSVLRNGGDIRFIQQILGHASVATTQI—-YTHLNDSALREXYTQHRPR 316

QUESTION 13: Do you find any significant (E<0.005) hits? What is the E-value of the best hit?

Answer: There are no significant hits. The best hit has an E-value of 5.8.

QUESTION 14: How many significant (E<0.005) hits do you find now? What is the E-value of the best hit?

Answer: There is 1 significant hit: “putative GPI transamidase component GAA1” from Trypanosoma theileri. It has an E-value of 4e-04.

Applications of PSI-BLAST in Bioinformatics

PSI-BLAST (Position-Specific Iterated BLAST) is a versatile tool in bioinformatics, with various applications, including:

  1. Protein Function Prediction: PSI-BLAST can be used to predict the function of a protein based on its sequence similarity to proteins of known function. By identifying homologous proteins with known functions, PSI-BLAST can infer the function of the query protein.
  2. Protein Structure Prediction: While PSI-BLAST itself does not predict protein structures, it can be used as a step in protein structure prediction pipelines. By identifying homologous proteins with known structures, PSI-BLAST can guide the modeling of the query protein’s structure.
  3. Homology Modeling: PSI-BLAST is commonly used in homology modeling, a technique used to predict the three-dimensional structure of a protein based on its sequence similarity to proteins of known structure. PSI-BLAST helps identify suitable template structures for modeling.
  4. Evolutionary Studies: PSI-BLAST is valuable in evolutionary studies for identifying evolutionarily related proteins. By detecting remote homologs that may have diverged significantly over evolutionary time, PSI-BLAST provides insights into protein evolution and function.
  5. Protein Family Analysis: PSI-BLAST can be used to identify members of a protein family or superfamily based on sequence similarity. This information is useful for studying protein function, evolution, and structure within a family.
  6. Database Annotation and Curation: PSI-BLAST can be used to annotate and curate protein sequence databases by identifying and classifying new sequences based on their similarity to known proteins.

Overall, PSI-BLAST is a powerful tool in bioinformatics, particularly for protein sequence analysis, structure prediction, and evolutionary studies. Its ability to detect remote homologs makes it invaluable in various applications across the field of bioinformatics.

Limitations and Challenges of PSI-BLAST

  1. Sensitivity and Specificity Trade-offs: While PSI-BLAST is more sensitive than regular BLAST in detecting remote homologs, this increased sensitivity can sometimes lead to an increase in false positives. Balancing sensitivity and specificity is a challenge, and users need to carefully interpret the results.
  2. Alignment Quality: The quality of the PSSM and subsequent iterations depends heavily on the quality of the initial alignments. Errors or biases in the initial alignments can propagate through the iterations, leading to inaccurate results.
  3. Convergence: The iterative nature of PSI-BLAST relies on reaching convergence, where no new significant hits are found. However, convergence can be influenced by factors such as the choice of database, the significance threshold, and the number of iterations, making it challenging to determine when to stop the iterations.
  4. Database Size and Complexity: Handling large and diverse sequence databases can be computationally intensive. As the database size increases, the time and memory requirements of PSI-BLAST also increase, posing challenges for analyzing large datasets efficiently.
  5. Overfitting: In some cases, PSI-BLAST may overfit the PSSM to the initial hits, leading to a biased model that may miss other relevant homologs. Careful validation and interpretation of the results are essential to avoid this issue.
  6. Database Bias: The results of PSI-BLAST can be influenced by the composition and redundancy of the database. Biases in the database, such as overrepresentation of certain protein families or species, can affect the performance and interpretation of PSI-BLAST results.
  7. Parameter Selection: PSI-BLAST requires the selection of various parameters, such as the number of iterations, the E-value threshold, and the gap penalties. Choosing appropriate parameters that balance sensitivity and specificity for a given dataset is non-trivial and may require manual tuning.

Despite these limitations, PSI-BLAST remains a valuable tool for protein sequence analysis, particularly in identifying remote homologs and inferring evolutionary relationships. Researchers need to be aware of these limitations and use PSI-BLAST in conjunction with other tools and validation methods to obtain reliable results.

Future Developments and Alternatives to PSI-BLAST

  1. Deep Learning Approaches: Deep learning methods, such as convolutional neural networks (CNNs) and recurrent neural networks (RNNs), are being increasingly applied to protein sequence analysis. These methods have shown promise in improving the accuracy of tasks such as protein function prediction, structure prediction, and sequence alignment.
  2. Graph Neural Networks: Graph neural networks (GNNs) are being used to model the complex relationships in protein sequences and structures. GNNs can capture long-range interactions and dependencies, which are critical for accurately predicting protein properties and functions.
  3. Multi-omics Integration: Integrating data from multiple omics layers (e.g., genomics, transcriptomics, proteomics) can provide a more comprehensive view of biological systems. Methods that can effectively integrate and analyze multi-omics data are expected to play a significant role in future protein sequence analysis.
  4. Structural Bioinformatics: Advancements in structural bioinformatics, such as improved methods for protein structure prediction and modeling, are enhancing our understanding of protein function and evolution.
  5. High-Performance Computing: Continued advancements in high-performance computing (HPC) are enabling the analysis of larger and more complex datasets, allowing for more detailed and accurate protein sequence analysis.

Alternatives to PSI-BLAST:

  1. HHblits: HHblits is a tool based on the HHsearch algorithm, which uses hidden Markov models (HMMs) to search for remote homologs. It is known for its sensitivity and ability to detect distant homologs.
  2. HMMER: HMMER is a suite of tools for protein sequence analysis that uses profile hidden Markov models (HMMs) to search for homologous sequences. It is widely used for protein family classification and annotation.
  3. JackHMMER: JackHMMER is an iterative search tool that builds on the HMMER framework. It is designed to be more sensitive than regular HMMER searches, making it suitable for detecting remote homologs.
  4. RPS-BLAST: RPS-BLAST is a variant of BLAST that searches a query sequence against a database of pre-constructed position-specific scoring matrices (PSSMs) representing protein domains from the Conserved Domain Database (CDD). It is useful for identifying conserved domains in proteins.
  5. DIAMOND: DIAMOND is a tool for rapidly aligning protein or nucleotide sequences against a protein reference database. It is known for its speed and is often used for large-scale sequence similarity searches.

Each of these tools has its strengths and weaknesses, and the choice of tool depends on the specific requirements of the analysis, such as sensitivity, speed, and the nature of the sequences being analyzed.

Conclusion

Summary of Key Points:

  • PSI-BLAST (Position-Specific Iterated BLAST) is an iterative search algorithm used in bioinformatics to find distant homologs of a protein sequence.
  • It builds a position-specific scoring matrix (PSSM) based on the alignments found in previous iterations, allowing for more sensitive detection of remote homologs.
  • PSI-BLAST is valuable for protein function prediction, structure prediction, homology modeling, and evolutionary studies.
  • However, it has limitations, including sensitivity-specificity trade-offs, alignment quality issues, convergence challenges, and database size handling.
  • Despite these limitations, PSI-BLAST remains a widely used tool in bioinformatics for its ability to detect remote homologs and infer evolutionary relationships.

Future Prospects of PSI-BLAST in Bioinformatics:

  • Integration with Deep Learning: Integration of PSI-BLAST with deep learning methods could enhance its sensitivity and specificity, leading to more accurate predictions.
  • Improvements in Convergence Criteria: Refining convergence criteria could help improve the accuracy and reliability of PSI-BLAST results.
  • Enhanced Database Handling: Continued advancements in database management and computational resources could help PSI-BLAST handle large datasets more efficiently.
  • Integration with Multi-omics Data: Integrating PSI-BLAST with multi-omics data could provide a more comprehensive understanding of protein function and evolution.
  • Application in Drug Discovery: PSI-BLAST could be further applied in drug discovery, particularly in identifying potential drug targets and understanding drug resistance mechanisms.

Overall, while PSI-BLAST has its limitations, ongoing developments and integrations with other methods are expected to enhance its capabilities and further its applications in bioinformatics and related fields.

Shares